PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009618868.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 357aa    MW: 40743.5 Da    PI: 4.9541
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009618868.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.6e-151465148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT....TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg....kgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++++G g+W+++++       + R++k+c++rw +yl
   XP_009618868.1 14 KGLWSPEEDEKLCNYITKFGVGCWSSVPKLAEilagLQRCGKSCRLRWINYL 65
                     678***********************************************97 PP

2Myb_DNA-binding52.51.1e-1671116148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE++++++++++lG++ W+ Ia+ ++ gRt++++k++w++yl
   XP_009618868.1  71 RGMFSQEEEDIILNLHELLGNR-WAQIAAQLP-GRTDNEIKNFWNSYL 116
                      788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.049965IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-23968IPR009057Homeodomain-like
SuperFamilySSF466896.74E-2912112IPR009057Homeodomain-like
SMARTSM007171.2E-101367IPR001005SANT/Myb domain
PfamPF002494.1E-131465IPR001005SANT/Myb domain
CDDcd001671.87E-91765No hitNo description
PROSITE profilePS5129426.02866120IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2669121IPR009057Homeodomain-like
SMARTSM007171.8E-1570118IPR001005SANT/Myb domain
PfamPF002491.3E-1571116IPR001005SANT/Myb domain
CDDcd001671.79E-1174116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGRHSVFVKE KLRKGLWSPE EDEKLCNYIT KFGVGCWSSV PKLAEILAGL QRCGKSCRLR  60
WINYLRPDLK RGMFSQEEED IILNLHELLG NRWAQIAAQL PGRTDNEIKN FWNSYLKKKL  120
IKQGIDPNTH KPLSENQVRN ETDCTDKASM LLIPQLPNMS ISAKMEQPFH LSETSVDCEA  180
NRQLTDASRN QLVSKQVFDP LFLYEFQAND DPSEYNSELL GQCQQNLRPY DHQNQIEGNP  240
NFGFCSMPSL TNFEHGHMTE TEFSDSSSSI MSLLYTSEAK ESSSNSSNMN NHHNAAEIQM  300
NEMVGNPQDL SWGSENKIDS LFQYPYGGIK NEEDFSNNPL SSLSEDTCGE NLVFHHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121205108B-MYB
1h8a_C3e-281212025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618868.10.0PREDICTED: myb-related protein 330-like isoform X1
TrEMBLM1CKU41e-158M1CKU4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000696441e-157(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-73myb domain protein 86